SCOPe 2.08: Domain d7dafd2: 7daf D:244-439

Lineage for d7dafd2 (7daf D:244-439)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (7 species)
not a true protein
Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries)

Domain d7dafd2: 7daf D:244-439 [401931]
Other proteins in same PDB: d7dafb1, d7dafc1, d7dafd1, d7dafe_, d7daff1, d7daff2, d7daff3
automated match to d3rycd2
complexed with acp, ca, cl, gdp, gtp, gzx, mes, mg

Details for d7dafd2

PDB Entry: 7daf (more details), 2.4 Å

PDB Description: ixa in complex with tubulin

PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d7dafd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dafd2 d.79.2.1 (D:244-439) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

SCOPe Domain Coordinates for d7dafd2:

Click to download the PDB-style file with coordinates for d7dafd2.
(The format of our PDB-style files is described here.)

Timeline for d7dafd2: