SCOPe 2.07: Domain d7cohr_: 7coh R:

Lineage for d7cohr_ (7coh R:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families)
   automatically mapped to Pfam PF02284

5. Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)

6. Protein Cytochrome c oxidase subunit E [48481] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48482] (49 PDB entries)

8. Domain d7cohr_: 7coh R: [401913]
   Other proteins in same PDB: d7coha_, d7cohb1, d7cohb2, d7cohc_, d7cohd_, d7cohf_, d7cohg_, d7cohh_, d7cohi_, d7cohj_, d7cohk_, d7cohl_, d7cohm_, d7cohn_, d7coho1, d7coho2, d7cohp_, d7cohq_, d7cohs_, d7coht_, d7cohu_, d7cohv_, d7cohw_, d7cohx_, d7cohy_, d7cohz_
   automated match to d1v54e_
   complexed with cdl, chd, cu, cua, dmu, edo, fme, hea, lfa, mg, na, pek, per, pgv, unx, zn

Details for d7cohr_

PDB Entry: 7coh, 1.3 Å

PDB Description: dimeric form of bovine heart cytochrome c oxidase in the fully oxidized state

PDB Compounds: (R:) Cytochrome c oxidase subunit 5A

SCOPe Domain Sequences for d7cohr_:

Sequence; same for both SEQRES and ATOM records:

>d7cohr_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
tdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasavr
ilevvkdkagphkeiypyviqelrptlnelgistpeelgldk

Timeline for d7cohr_:

• d7cohr_ is new in SCOPe 2.07-stable
  
• d7cohr_ appears in the current release, SCOPe 2.08