Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) both first two domains are of same beta/beta/alpha fold |
Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins) |
Protein Trypanothione reductase [55429] (3 species) |
Species Trypanosoma cruzi [TaxId:5693] [55431] (4 PDB entries) |
Domain d1aoga3: 1aog A:358-487 [40190] Other proteins in same PDB: d1aoga1, d1aoga2, d1aogb1, d1aogb2 complexed with fad, mae |
PDB Entry: 1aog (more details), 2.3 Å
SCOPe Domain Sequences for d1aoga3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aoga3 d.87.1.1 (A:358-487) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} dhtrvasavfsippigtcglieevaskryevvavylssftplmhkvsgskyktfvakiit nhsdgtvlgvhllgdnapeiiqgigiclklnakisdfyntigvhptsaeelcsmrtpsyy yvkgekmekp
Timeline for d1aoga3: