Lineage for d1aoga3 (1aog A:358-487)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607191Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 607192Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 607193Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 607299Protein Trypanothione reductase [55429] (2 species)
  7. 607315Species Trypanosoma cruzi [TaxId:5693] [55431] (4 PDB entries)
  8. 607316Domain d1aoga3: 1aog A:358-487 [40190]
    Other proteins in same PDB: d1aoga1, d1aoga2, d1aogb1, d1aogb2

Details for d1aoga3

PDB Entry: 1aog (more details), 2.3 Å

PDB Description: trypanosoma cruzi trypanothione reductase (oxidized form)

SCOP Domain Sequences for d1aoga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aoga3 d.87.1.1 (A:358-487) Trypanothione reductase {Trypanosoma cruzi}
dhtrvasavfsippigtcglieevaskryevvavylssftplmhkvsgskyktfvakiit
nhsdgtvlgvhllgdnapeiiqgigiclklnakisdfyntigvhptsaeelcsmrtpsyy
yvkgekmekp

SCOP Domain Coordinates for d1aoga3:

Click to download the PDB-style file with coordinates for d1aoga3.
(The format of our PDB-style files is described here.)

Timeline for d1aoga3: