Lineage for d7ce2a1 (7ce2 A:869-1110)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779820Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins)
    automatically mapped to Pfam PF07953
  6. 2779869Protein automated matches [229097] (6 species)
    not a true protein
  7. 2779895Species Clostridium tetani [TaxId:1513] [232491] (3 PDB entries)
  8. 2779897Domain d7ce2a1: 7ce2 A:869-1110 [401896]
    Other proteins in same PDB: d7ce2a2, d7ce2b1, d7ce2b2, d7ce2z1, d7ce2z2
    automated match to d1a8da1

Details for d7ce2a1

PDB Entry: 7ce2 (more details), 2.01 Å

PDB Description: the crystal structure of tent hc complexed with neutralizing antibody
PDB Compounds: (A:) Tetanus toxin

SCOPe Domain Sequences for d7ce2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ce2a1 b.29.1.6 (A:869-1110) automated matches {Clostridium tetani [TaxId: 1513]}
cwvdneedidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaihlvnn
essevivhkamdieyndmfnnftvsfwlrvpkvsashleqydtneysiissmkkyslsig
sgwsvslkgnnliwtlkdsagevrqitfrdlsdkfnaylankwvfititndrlssanlyi
ngvlmgsaeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeieklytsy
ls

SCOPe Domain Coordinates for d7ce2a1:

Click to download the PDB-style file with coordinates for d7ce2a1.
(The format of our PDB-style files is described here.)

Timeline for d7ce2a1: