Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins) automatically mapped to Pfam PF07953 |
Protein automated matches [229097] (6 species) not a true protein |
Species Clostridium tetani [TaxId:1513] [232491] (3 PDB entries) |
Domain d7ce2a1: 7ce2 A:869-1110 [401896] Other proteins in same PDB: d7ce2a2, d7ce2b1, d7ce2b2, d7ce2z1, d7ce2z2 automated match to d1a8da1 |
PDB Entry: 7ce2 (more details), 2.01 Å
SCOPe Domain Sequences for d7ce2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ce2a1 b.29.1.6 (A:869-1110) automated matches {Clostridium tetani [TaxId: 1513]} cwvdneedidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaihlvnn essevivhkamdieyndmfnnftvsfwlrvpkvsashleqydtneysiissmkkyslsig sgwsvslkgnnliwtlkdsagevrqitfrdlsdkfnaylankwvfititndrlssanlyi ngvlmgsaeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeieklytsy ls
Timeline for d7ce2a1:
View in 3D Domains from other chains: (mouse over for more information) d7ce2b1, d7ce2b2, d7ce2z1, d7ce2z2 |