Class g: Small proteins [56992] (100 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.5: Rubredoxin-like [57802] (4 families) |
Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins) membrane-anchored rubredoxin-like domain automatically mapped to Pfam PF01215 |
Protein Cytochrome c oxidase Subunit F [57819] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [57820] (50 PDB entries) |
Domain d7cohf_: 7coh F: [401893] Other proteins in same PDB: d7coha_, d7cohb1, d7cohb2, d7cohc_, d7cohd_, d7cohe_, d7cohg_, d7cohh_, d7cohi_, d7cohj_, d7cohk_, d7cohl_, d7cohm_, d7cohn_, d7coho1, d7coho2, d7cohp_, d7cohq_, d7cohr_, d7coht_, d7cohu_, d7cohv_, d7cohw_, d7cohx_, d7cohy_, d7cohz_ automated match to d1v54f_ complexed with cdl, chd, cu, cua, dmu, edo, fme, hea, lfa, mg, na, pek, per, pgv, unx, zn |
PDB Entry: 7coh (more details), 1.3 Å
SCOPe Domain Sequences for d7cohf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cohf_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]} gggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgcic eednstviwfwlhkgeaqrcpscgthyklvp
Timeline for d7cohf_:
View in 3D Domains from other chains: (mouse over for more information) d7coha_, d7cohb1, d7cohb2, d7cohc_, d7cohd_, d7cohe_, d7cohg_, d7cohh_, d7cohi_, d7cohj_, d7cohk_, d7cohl_, d7cohm_, d7cohn_, d7coho1, d7coho2, d7cohp_, d7cohq_, d7cohr_, d7cohs_, d7coht_, d7cohu_, d7cohv_, d7cohw_, d7cohx_, d7cohy_, d7cohz_ |