Class b: All beta proteins [48724] (180 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
Protein automated matches [190701] (13 species) not a true protein |
Species Janthinobacterium sp. [TaxId:213804] [399621] (9 PDB entries) |
Domain d7buib1: 7bui B:2-142 [401887] Other proteins in same PDB: d7buia2, d7buia3, d7buib2, d7buib3, d7buic2, d7buic3 automated match to d2de6a1 complexed with edo, fe2, fes, peg |
PDB Entry: 7bui (more details), 2.15 Å
SCOPe Domain Sequences for d7buib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7buib1 b.33.1.0 (B:2-142) automated matches {Janthinobacterium sp. [TaxId: 213804]} anvdeailkrvkgwapyvdaklgfrnhwypvmfskeinegepktlkllgenllvnridgk lyclkdrclhrgvqlsvkvecktkstitcwyhawtyrwedgvlcdiltnptsaqigrqkl ktypvqeakgcvfiylgdgdp
Timeline for d7buib1: