SCOPe 2.08: Domain d1tyta3: 1tyt A:359-487

Lineage for d1tyta3 (1tyt A:359-487)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)
   both first two domains are of same beta/beta/alpha fold

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)

6. Protein Trypanothione reductase [55429] (3 species)

7. Species Crithidia fasciculata [TaxId:5656] [55430] (6 PDB entries)

8. Domain d1tyta3: 1tyt A:359-487 [40188]
   Other proteins in same PDB: d1tyta1, d1tyta2, d1tytb1, d1tytb2
   complexed with fad

Details for d1tyta3

PDB Entry: 1tyt, 2.6 Å

PDB Description: crystal and molecular structure of crithidia fasciculata trypanothione reductase at 2.6 angstroms resolution

PDB Compounds: (A:) trypanothione reductase, oxidized form

SCOPe Domain Sequences for d1tyta3:

Sequence; same for both SEQRES and ATOM records:

>d1tyta3 d.87.1.1 (A:359-487) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}
htkvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtn
hadgevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfy
qkgkrveki

Timeline for d1tyta3:

• d1tyta3 first appeared (with stable ids) in SCOP 1.55
  
• d1tyta3 appears in SCOPe 2.07