Lineage for d7d1uz_ (7d1u Z:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023860Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 3024237Superfamily f.17.5: PsbZ-like [161055] (2 families) (S)
    automatically mapped to Pfam PF01737
  5. 3024238Family f.17.5.1: PsbZ-like [161056] (1 protein)
    Pfam PF01737; Ycf9
  6. 3024239Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species)
  7. 3024250Species Thermosynechococcus vulcanus [TaxId:32053] [192451] (30 PDB entries)
  8. 3024260Domain d7d1uz_: 7d1u Z: [401870]
    Other proteins in same PDB: d7d1ua_, d7d1ub_, d7d1uc_, d7d1ud_, d7d1ue_, d7d1uf_, d7d1uh_, d7d1uj_, d7d1uk_, d7d1ul_, d7d1um_, d7d1uo_, d7d1uu_, d7d1uv_, d7d1ux_
    automated match to d3a0hz_
    complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d7d1uz_

PDB Entry: 7d1u (more details), 2.08 Å

PDB Description: cryo-em structure of psii at 2.08 angstrom resolution
PDB Compounds: (Z:) Photosystem II reaction center protein Z

SCOPe Domain Sequences for d7d1uz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d1uz_ f.17.5.1 (Z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus vulcanus [TaxId: 32053]}
mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
vv

SCOPe Domain Coordinates for d7d1uz_:

Click to download the PDB-style file with coordinates for d7d1uz_.
(The format of our PDB-style files is described here.)

Timeline for d7d1uz_: