Lineage for d1typb3 (1typ B:359-487)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1422939Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 1422940Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 1422941Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 1423069Protein Trypanothione reductase [55429] (2 species)
  7. 1423070Species Crithidia fasciculata [TaxId:5656] [55430] (6 PDB entries)
  8. 1423082Domain d1typb3: 1typ B:359-487 [40187]
    Other proteins in same PDB: d1typa1, d1typa2, d1typb1, d1typb2
    complexed with fad, gsh, nap

Details for d1typb3

PDB Entry: 1typ (more details), 2.8 Å

PDB Description: substrate interactions between trypanothione reductase and n1-glutathionylspermidine disulphide at 0.28-nm resolution
PDB Compounds: (B:) trypanothione reductase

SCOPe Domain Sequences for d1typb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1typb3 d.87.1.1 (B:359-487) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}
htkvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtn
hadgevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfy
qkgkrveki

SCOPe Domain Coordinates for d1typb3:

Click to download the PDB-style file with coordinates for d1typb3.
(The format of our PDB-style files is described here.)

Timeline for d1typb3: