SCOP 1.59: Domain d1typb3: 1typ B:359-487

Lineage for d1typb3 (1typ B:359-487)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (8 proteins)

6. Protein Trypanothione reductase [55429] (2 species)

7. Species Crithidia fasciculata [TaxId:5656] [55430] (6 PDB entries)

8. Domain d1typb3: 1typ B:359-487 [40187]
   Other proteins in same PDB: d1typa1, d1typa2, d1typb1, d1typb2

Details for d1typb3

PDB Entry: 1typ, 2.8 Å

PDB Description: substrate interactions between trypanothione reductase and n1-glutathionylspermidine disulphide at 0.28-nm resolution

SCOP Domain Sequences for d1typb3:

Sequence; same for both SEQRES and ATOM records:

>d1typb3 d.87.1.1 (B:359-487) Trypanothione reductase {Crithidia fasciculata}
htkvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtn
hadgevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfy
qkgkrveki

Timeline for d1typb3:

• d1typb3 first appeared (with stable ids) in SCOP 1.55
  
• d1typb3 appears in SCOP 1.57
  
• d1typb3 appears in SCOP 1.61
  
• d1typb3 appears in the current release, SCOPe 2.08