SCOPe 2.08: Domain d7buga1: 7bug A:2-142

Lineage for d7buga1 (7bug A:2-142)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.0: automated matches [191455] (1 protein)
   not a true family

6. Protein automated matches [190701] (13 species)
   not a true protein

7. Species Janthinobacterium sp. [TaxId:213804] [399621] (9 PDB entries)

8. Domain d7buga1: 7bug A:2-142 [401860]
   Other proteins in same PDB: d7buga2, d7bugb2, d7bugc2
   automated match to d2de6a1
   complexed with 1pe, co3, fe2, fes, mg, mxe, p6g, peg, pg0, pg4, pge

Details for d7buga1

PDB Entry: 7bug, 1.6 Å

PDB Description: reduced oxygenase of carbazole 1,9a-dioxygenase

PDB Compounds: (A:) terminal oxygenase component of carbazole

SCOPe Domain Sequences for d7buga1:

Sequence; same for both SEQRES and ATOM records:

>d7buga1 b.33.1.0 (A:2-142) automated matches {Janthinobacterium sp. [TaxId: 213804]}
anvdeailkrvkgwapyvdaklgfrnhwypvmfskeinegepktlkllgenllvnridgk
lyclkdrclhrgvqlsvkvecktkstitcwyhawtyrwedgvlcdiltnptsaqigrqkl
ktypvqeakgcvfiylgdgdp

Timeline for d7buga1:

• d7buga1 first appeared in SCOPe 2.07