SCOPe 2.07: Domain d7cohp_: 7coh P:

Lineage for d7cohp_ (7coh P:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
   core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest

4. Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families)
   automatically mapped to Pfam PF00510

5. Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
   function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel

6. Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81444] (52 PDB entries)

8. Domain d7cohp_: 7coh P: [401856]
   Other proteins in same PDB: d7coha_, d7cohb1, d7cohb2, d7cohd_, d7cohe_, d7cohf_, d7cohg_, d7cohh_, d7cohi_, d7cohj_, d7cohk_, d7cohl_, d7cohm_, d7cohn_, d7coho1, d7coho2, d7cohq_, d7cohr_, d7cohs_, d7coht_, d7cohu_, d7cohv_, d7cohw_, d7cohx_, d7cohy_, d7cohz_
   automated match to d1v54c_
   complexed with cdl, chd, cu, cua, dmu, edo, fme, hea, lfa, mg, na, pek, per, pgv, unx, zn

Details for d7cohp_

PDB Entry: 7coh, 1.3 Å

PDB Description: dimeric form of bovine heart cytochrome c oxidase in the fully oxidized state

PDB Compounds: (P:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d7cohp_:

Sequence; same for both SEQRES and ATOM records:

>d7cohp_ f.25.1.1 (P:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
qthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvir
estfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgihp
lnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyye
apftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawywh
fvdvvwlflyvsiywwgs

Timeline for d7cohp_:

• d7cohp_ is new in SCOPe 2.07-stable
  
• d7cohp_ appears in the current release, SCOPe 2.08