Lineage for d7bq5l1 (7bq5 L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (30 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1747 PDB entries)
  8. 2757583Domain d7bq5l1: 7bq5 L:1-107 [401850]
    Other proteins in same PDB: d7bq5a1, d7bq5a2, d7bq5b1, d7bq5b2, d7bq5c2, d7bq5h2
    automated match to d1dqdl1

Details for d7bq5l1

PDB Entry: 7bq5 (more details), 2.99 Å

PDB Description: zikv se bound to mab z6
PDB Compounds: (L:) Z6 Light Chain

SCOPe Domain Sequences for d7bq5l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bq5l1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divltqspsflsasvgdrvtitcrasqgidtylawyqqkpgkapklliygastlqsgvps
rfsgsgsgteftltisslqpedfatyycqqlnnyhftfgpgtkvdik

SCOPe Domain Coordinates for d7bq5l1:

Click to download the PDB-style file with coordinates for d7bq5l1.
(The format of our PDB-style files is described here.)

Timeline for d7bq5l1: