Lineage for d2tprb3 (2tpr B:358-482)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135463Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 135464Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
  5. 135465Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (8 proteins)
  6. 135546Protein Trypanothione reductase [55429] (2 species)
  7. 135547Species Crithidia fasciculata [TaxId:5656] [55430] (6 PDB entries)
  8. 135557Domain d2tprb3: 2tpr B:358-482 [40185]
    Other proteins in same PDB: d2tpra1, d2tpra2, d2tprb1, d2tprb2

Details for d2tprb3

PDB Entry: 2tpr (more details), 2.4 Å

PDB Description: x-ray structure of trypanothione reductase from crithidia fasciculata at 2.4 angstroms resolution

SCOP Domain Sequences for d2tprb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tprb3 d.87.1.1 (B:358-482) Trypanothione reductase {Crithidia fasciculata}
htkvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtn
hadgevlgvhmlgdsspeiiqsvaiclkmgakisdvyntigvhptsaeelcsmrtpayfy
ekgkr

SCOP Domain Coordinates for d2tprb3:

Click to download the PDB-style file with coordinates for d2tprb3.
(The format of our PDB-style files is described here.)

Timeline for d2tprb3: