![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) |
![]() | Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) ![]() |
![]() | Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (7 proteins) |
![]() | Protein Trypanothione reductase [55429] (2 species) |
![]() | Species Crithidia fasciculata [TaxId:5656] [55430] (6 PDB entries) |
![]() | Domain d2tprb3: 2tpr B:358-482 [40185] Other proteins in same PDB: d2tpra1, d2tpra2, d2tprb1, d2tprb2 |
PDB Entry: 2tpr (more details), 2.4 Å
SCOP Domain Sequences for d2tprb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tprb3 d.87.1.1 (B:358-482) Trypanothione reductase {Crithidia fasciculata} htkvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtn hadgevlgvhmlgdsspeiiqsvaiclkmgakisdvyntigvhptsaeelcsmrtpayfy ekgkr
Timeline for d2tprb3: