Lineage for d2tprb3 (2tpr B:358-482)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962835Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2962836Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2962837Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2962968Protein Trypanothione reductase [55429] (3 species)
  7. 2962969Species Crithidia fasciculata [TaxId:5656] [55430] (6 PDB entries)
  8. 2962979Domain d2tprb3: 2tpr B:358-482 [40185]
    Other proteins in same PDB: d2tpra1, d2tpra2, d2tprb1, d2tprb2
    complexed with fad

Details for d2tprb3

PDB Entry: 2tpr (more details), 2.4 Å

PDB Description: x-ray structure of trypanothione reductase from crithidia fasciculata at 2.4 angstroms resolution
PDB Compounds: (B:) trypanothione reductase

SCOPe Domain Sequences for d2tprb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tprb3 d.87.1.1 (B:358-482) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}
htkvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtn
hadgevlgvhmlgdsspeiiqsvaiclkmgakisdvyntigvhptsaeelcsmrtpayfy
ekgkr

SCOPe Domain Coordinates for d2tprb3:

Click to download the PDB-style file with coordinates for d2tprb3.
(The format of our PDB-style files is described here.)

Timeline for d2tprb3: