Lineage for d7cohe_ (7coh E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727193Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) (S)
    automatically mapped to Pfam PF02284
  5. 2727194Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)
  6. 2727195Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 2727196Species Cow (Bos taurus) [TaxId:9913] [48482] (50 PDB entries)
  8. 2727197Domain d7cohe_: 7coh E: [401834]
    Other proteins in same PDB: d7coha_, d7cohb1, d7cohb2, d7cohc_, d7cohd_, d7cohf_, d7cohg_, d7cohh_, d7cohi_, d7cohj_, d7cohk_, d7cohl_, d7cohm_, d7cohn_, d7coho1, d7coho2, d7cohp_, d7cohq_, d7cohs_, d7coht_, d7cohu_, d7cohv_, d7cohw_, d7cohx_, d7cohy_, d7cohz_
    automated match to d1v54e_
    complexed with cdl, chd, cu, cua, dmu, edo, fme, hea, lfa, mg, na, pek, per, pgv, unx, zn

Details for d7cohe_

PDB Entry: 7coh (more details), 1.3 Å

PDB Description: dimeric form of bovine heart cytochrome c oxidase in the fully oxidized state
PDB Compounds: (E:) Cytochrome c oxidase subunit 5A

SCOPe Domain Sequences for d7cohe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cohe_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
tdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasavr
ilevvkdkagphkeiypyviqelrptlnelgistpeelgldk

SCOPe Domain Coordinates for d7cohe_:

Click to download the PDB-style file with coordinates for d7cohe_.
(The format of our PDB-style files is described here.)

Timeline for d7cohe_: