![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) |
![]() | Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) ![]() |
![]() | Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (7 proteins) |
![]() | Protein Trypanothione reductase [55429] (2 species) |
![]() | Species Crithidia fasciculata [TaxId:5656] [55430] (6 PDB entries) |
![]() | Domain d1fead3: 1fea D:358-484 [40183] Other proteins in same PDB: d1feaa1, d1feaa2, d1feab1, d1feab2, d1feac1, d1feac2, d1fead1, d1fead2 |
PDB Entry: 1fea (more details), 2.2 Å
SCOP Domain Sequences for d1fead3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fead3 d.87.1.1 (D:358-484) Trypanothione reductase {Crithidia fasciculata} htkvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtn hadgevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfy ekgkrve
Timeline for d1fead3: