![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
![]() | Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) ![]() both first two domains are of same beta/beta/alpha fold |
![]() | Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (10 proteins) |
![]() | Protein Trypanothione reductase [55429] (2 species) |
![]() | Species Crithidia fasciculata [TaxId:5656] [55430] (6 PDB entries) |
![]() | Domain d1feac3: 1fea C:358-487 [40182] Other proteins in same PDB: d1feaa1, d1feaa2, d1feab1, d1feab2, d1feac1, d1feac2, d1fead1, d1fead2 |
PDB Entry: 1fea (more details), 2.2 Å
SCOP Domain Sequences for d1feac3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1feac3 d.87.1.1 (C:358-487) Trypanothione reductase {Crithidia fasciculata} htkvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtn hadgevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfy ekgkrvekid
Timeline for d1feac3: