Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d7bq5d1: 7bq5 D:1-107 [401811] Other proteins in same PDB: d7bq5a1, d7bq5a2, d7bq5b1, d7bq5b2, d7bq5c2, d7bq5h2 automated match to d1dqdl1 |
PDB Entry: 7bq5 (more details), 2.99 Å
SCOPe Domain Sequences for d7bq5d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7bq5d1 b.1.1.0 (D:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]} divltqspsflsasvgdrvtitcrasqgidtylawyqqkpgkapklliygastlqsgvps rfsgsgsgteftltisslqpedfatyycqqlnnyhftfgpgtkvdik
Timeline for d7bq5d1: