SCOPe 2.08: Domain d7bq5d1: 7bq5 D:1-107

Lineage for d7bq5d1 (7bq5 D:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d7bq5d1: 7bq5 D:1-107 [401811]
   Other proteins in same PDB: d7bq5a1, d7bq5a2, d7bq5b1, d7bq5b2, d7bq5c2, d7bq5h2
   automated match to d1dqdl1

Details for d7bq5d1

PDB Entry: 7bq5, 2.99 Å

PDB Description: zikv se bound to mab z6

PDB Compounds: (D:) Z6 Light Chain

SCOPe Domain Sequences for d7bq5d1:

Sequence; same for both SEQRES and ATOM records:

>d7bq5d1 b.1.1.0 (D:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divltqspsflsasvgdrvtitcrasqgidtylawyqqkpgkapklliygastlqsgvps
rfsgsgsgteftltisslqpedfatyycqqlnnyhftfgpgtkvdik

Timeline for d7bq5d1:

• d7bq5d1 first appeared in SCOPe 2.07