Lineage for d1feab3 (1fea B:358-484)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34139Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 34140Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
  5. 34141Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (7 proteins)
  6. 34209Protein Trypanothione reductase [55429] (2 species)
  7. 34210Species Crithidia fasciculata [TaxId:5656] [55430] (6 PDB entries)
  8. 34216Domain d1feab3: 1fea B:358-484 [40181]
    Other proteins in same PDB: d1feaa1, d1feaa2, d1feab1, d1feab2, d1feac1, d1feac2, d1fead1, d1fead2

Details for d1feab3

PDB Entry: 1fea (more details), 2.2 Å

PDB Description: unliganded crithidia fasciculata trypanothione reductase at 2.2 angstrom resolution

SCOP Domain Sequences for d1feab3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1feab3 d.87.1.1 (B:358-484) Trypanothione reductase {Crithidia fasciculata}
htkvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtn
hadgevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfy
ekgkrve

SCOP Domain Coordinates for d1feab3:

Click to download the PDB-style file with coordinates for d1feab3.
(The format of our PDB-style files is described here.)

Timeline for d1feab3: