Lineage for d1feaa3 (1fea A:358-487)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81993Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 81994Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
  5. 81995Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (8 proteins)
  6. 82075Protein Trypanothione reductase [55429] (2 species)
  7. 82076Species Crithidia fasciculata [TaxId:5656] [55430] (6 PDB entries)
  8. 82081Domain d1feaa3: 1fea A:358-487 [40180]
    Other proteins in same PDB: d1feaa1, d1feaa2, d1feab1, d1feab2, d1feac1, d1feac2, d1fead1, d1fead2

Details for d1feaa3

PDB Entry: 1fea (more details), 2.2 Å

PDB Description: unliganded crithidia fasciculata trypanothione reductase at 2.2 angstrom resolution

SCOP Domain Sequences for d1feaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1feaa3 d.87.1.1 (A:358-487) Trypanothione reductase {Crithidia fasciculata}
htkvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtn
hadgevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfy
ekgkrvekid

SCOP Domain Coordinates for d1feaa3:

Click to download the PDB-style file with coordinates for d1feaa3.
(The format of our PDB-style files is described here.)

Timeline for d1feaa3: