SCOPe 2.05: Domain d1febb3: 1feb B:358-484

Lineage for d1febb3 (1feb B:358-484)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)
   both first two domains are of same beta/beta/alpha fold

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)

6. Protein Trypanothione reductase [55429] (3 species)

7. Species Crithidia fasciculata [TaxId:5656] [55430] (6 PDB entries)

8. Domain d1febb3: 1feb B:358-484 [40179]
   Other proteins in same PDB: d1feba1, d1feba2, d1febb1, d1febb2
   complexed with fad

Details for d1febb3

PDB Entry: 1feb, 2 Å

PDB Description: unliganded crithidia fasciculata trypanothione reductase at 2.0 angstrom resolution

PDB Compounds: (B:) trypanothione reductase

SCOPe Domain Sequences for d1febb3:

Sequence; same for both SEQRES and ATOM records:

>d1febb3 d.87.1.1 (B:358-484) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}
htkvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtn
hadgevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfy
ekgkrve

Timeline for d1febb3:

• d1febb3 first appeared (with stable ids) in SCOP 1.55
  
• d1febb3 appears in SCOPe 2.04
  
• d1febb3 appears in SCOPe 2.06
  
• d1febb3 appears in the current release, SCOPe 2.08