SCOPe 2.08: Domain d7cb5a1: 7cb5 A:1-175

Lineage for d7cb5a1 (7cb5 A:1-175)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:426430] [401772] (4 PDB entries)

8. Domain d7cb5a1: 7cb5 A:1-175 [401780]
   Other proteins in same PDB: d7cb5a2, d7cb5b2, d7cb5c2, d7cb5d2
   automated match to d2w8za1
   complexed with 6pg

Details for d7cb5a1

PDB Entry: 7cb5, 2.54 Å

PDB Description: the 6-phosphogluconate dehydrogenase from staphylococcus aureus (6- phosphogluconate bound)

PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d7cb5a1:

Sequence; same for both SEQRES and ATOM records:

>d7cb5a1 c.2.1.0 (A:1-175) automated matches {Staphylococcus aureus [TaxId: 426430]}
mtqqigviglavmgknlawniesrgysvsvfnrssektdlmveeskgknihptysleefv
nslekprkillmvqagkatdatidsllpllddgdilidggntnyqdtirrnkalaqsain
figmgvsggeigaltgpslmpggqeeaynkvadildaiaakakdgascvtyigpn

Timeline for d7cb5a1:

• d7cb5a1 first appeared in SCOPe 2.07