SCOP 1.59: Domain d1feba3: 1feb A:358-487

Lineage for d1feba3 (1feb A:358-487)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (8 proteins)

6. Protein Trypanothione reductase [55429] (2 species)

7. Species Crithidia fasciculata [TaxId:5656] [55430] (6 PDB entries)

8. Domain d1feba3: 1feb A:358-487 [40178]
   Other proteins in same PDB: d1feba1, d1feba2, d1febb1, d1febb2

Details for d1feba3

PDB Entry: 1feb, 2 Å

PDB Description: unliganded crithidia fasciculata trypanothione reductase at 2.0 angstrom resolution

SCOP Domain Sequences for d1feba3:

Sequence; same for both SEQRES and ATOM records:

>d1feba3 d.87.1.1 (A:358-487) Trypanothione reductase {Crithidia fasciculata}
htkvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtn
hadgevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfy
ekgkrvekid

Timeline for d1feba3:

• d1feba3 first appeared (with stable ids) in SCOP 1.55
  
• d1feba3 appears in SCOP 1.57
  
• d1feba3 appears in SCOP 1.61
  
• d1feba3 appears in the current release, SCOPe 2.08