Lineage for d1fecb3 (1fec B:358-486)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569462Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2569463Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2569464Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2569595Protein Trypanothione reductase [55429] (3 species)
  7. 2569596Species Crithidia fasciculata [TaxId:5656] [55430] (6 PDB entries)
  8. 2569598Domain d1fecb3: 1fec B:358-486 [40177]
    Other proteins in same PDB: d1feca1, d1feca2, d1fecb1, d1fecb2
    complexed with fad

Details for d1fecb3

PDB Entry: 1fec (more details), 1.7 Å

PDB Description: unliganded crithidia fasciculata trypanothione reductase at 1.7 angstrom resolution
PDB Compounds: (B:) trypanothione reductase

SCOPe Domain Sequences for d1fecb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fecb3 d.87.1.1 (B:358-486) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}
htkvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtn
hadgevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfy
ekgkrveki

SCOPe Domain Coordinates for d1fecb3:

Click to download the PDB-style file with coordinates for d1fecb3.
(The format of our PDB-style files is described here.)

Timeline for d1fecb3: