SCOP 1.71: Domain d1fecb3: 1fec B:358-486

Lineage for d1fecb3 (1fec B:358-486)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)
   both first two domains are of same beta/beta/alpha fold

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)

6. Protein Trypanothione reductase [55429] (2 species)

7. Species Crithidia fasciculata [TaxId:5656] [55430] (6 PDB entries)

8. Domain d1fecb3: 1fec B:358-486 [40177]
   Other proteins in same PDB: d1feca1, d1feca2, d1fecb1, d1fecb2
   complexed with fad

Details for d1fecb3

PDB Entry: 1fec, 1.7 Å

PDB Description: unliganded crithidia fasciculata trypanothione reductase at 1.7 angstrom resolution

SCOP Domain Sequences for d1fecb3:

Sequence; same for both SEQRES and ATOM records:

>d1fecb3 d.87.1.1 (B:358-486) Trypanothione reductase {Crithidia fasciculata}
htkvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtn
hadgevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfy
ekgkrveki

Timeline for d1fecb3:

• d1fecb3 first appeared (with stable ids) in SCOP 1.55
  
• d1fecb3 appears in SCOP 1.69
  
• d1fecb3 appears in SCOP 1.73
  
• d1fecb3 appears in the current release, SCOPe 2.08