SCOP 1.59: Domain d1geub3: 1geu B:336-450

Lineage for d1geub3 (1geu B:336-450)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (8 proteins)

6. Protein Glutathione reductase [55426] (2 species)

7. Species Escherichia coli [TaxId:562] [55428] (4 PDB entries)

8. Domain d1geub3: 1geu B:336-450 [40175]
   Other proteins in same PDB: d1geua1, d1geua2, d1geub1, d1geub2

Details for d1geub3

PDB Entry: 1geu, 2.2 Å

PDB Description: anatomy of an engineered nad-binding site

SCOP Domain Sequences for d1geub3:

Sequence; same for both SEQRES and ATOM records:

>d1geub3 d.87.1.1 (B:336-450) Glutathione reductase {Escherichia coli}
ysniptvvfshppigtvgltepqareqygddqvkvykssftamytavtthrqpcrmklvc
vgseekivgihgigfgmdemlqgfavalkmgatkkdfdntvaihptaaeefvtmr

Timeline for d1geub3:

• d1geub3 first appeared (with stable ids) in SCOP 1.55
  
• d1geub3 appears in SCOP 1.57
  
• d1geub3 appears in SCOP 1.61
  
• d1geub3 appears in the current release, SCOPe 2.08