Lineage for d7br4a2 (7br4 A:182-468)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2999460Family d.162.1.2: AglA-like glucosidase [90050] (5 proteins)
    family 4 glycosyl hydrolase
    automatically mapped to Pfam PF11975
  6. 2999500Protein automated matches [227094] (4 species)
    not a true protein
  7. 2999511Species Thermotoga maritima [TaxId:243274] [384650] (3 PDB entries)
  8. 2999512Domain d7br4a2: 7br4 A:182-468 [401745]
    Other proteins in same PDB: d7br4a1, d7br4a3
    automated match to d1vjta2
    complexed with mn, nai; mutant

Details for d7br4a2

PDB Entry: 7br4 (more details), 1.95 Å

PDB Description: structure of deletion mutant of alpha-glucuronidase (tm0752) from thermotoga maritima
PDB Compounds: (A:) Alpha-glucosidase, putative

SCOPe Domain Sequences for d7br4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7br4a2 d.162.1.2 (A:182-468) automated matches {Thermotoga maritima [TaxId: 243274]}
hgvagvyevfekldldpeevdwqvagvnhgiwlnrfryrgedayplldewiekklpewep
knpwdtqmspaamdmykfygmlpigdtvrngswkyhynletkkkwfgkfggidneverpk
fheqlrrarerliklaeevqqnpgmklteehpeifpkgklsgeqhipfinaiannkrvrl
flnvenqgtlkdfpddvvmelpvwvdccgihrekvepdlthrikiylwprilrmewnlea
yisrdrkvleeilirdprtksyeqivqvldeifnlpfneelrryyk

SCOPe Domain Coordinates for d7br4a2:

Click to download the PDB-style file with coordinates for d7br4a2.
(The format of our PDB-style files is described here.)

Timeline for d7br4a2: