SCOPe 2.07: Domain d7bq5a2: 7bq5 A:304-406

Lineage for d7bq5a2 (7bq5 A:304-406)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (72 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [317280] (7 PDB entries)

8. Domain d7bq5a2: 7bq5 A:304-406 [401743]
   Other proteins in same PDB: d7bq5a1, d7bq5b1, d7bq5d1, d7bq5d2, d7bq5l1, d7bq5l2
   automated match to d4gsxa2

Details for d7bq5a2

PDB Entry: 7bq5, 2.99 Å

PDB Description: zikv se bound to mab z6

PDB Compounds: (A:) envelope protein

SCOPe Domain Sequences for d7bq5a2:

Sequence; same for both SEQRES and ATOM records:

>d7bq5a2 b.1.18.0 (A:304-406) automated matches {Zika virus [TaxId: 64320]}
syslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanp
vitestenskmmleldppfgdsyivigvgekkithhwhrsgst

Timeline for d7bq5a2:

• d7bq5a2 is new in SCOPe 2.07-stable
  
• d7bq5a2 appears in the current release, SCOPe 2.08