Lineage for d7bq5a2 (7bq5 A:304-406)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2376005Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2376006Protein automated matches [190226] (72 species)
    not a true protein
  7. 2376421Species Zika virus [TaxId:64320] [317280] (7 PDB entries)
  8. 2376426Domain d7bq5a2: 7bq5 A:304-406 [401743]
    Other proteins in same PDB: d7bq5a1, d7bq5b1, d7bq5d1, d7bq5d2, d7bq5l1, d7bq5l2
    automated match to d4gsxa2

Details for d7bq5a2

PDB Entry: 7bq5 (more details), 2.99 Å

PDB Description: zikv se bound to mab z6
PDB Compounds: (A:) envelope protein

SCOPe Domain Sequences for d7bq5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bq5a2 b.1.18.0 (A:304-406) automated matches {Zika virus [TaxId: 64320]}
syslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanp
vitestenskmmleldppfgdsyivigvgekkithhwhrsgst

SCOPe Domain Coordinates for d7bq5a2:

Click to download the PDB-style file with coordinates for d7bq5a2.
(The format of our PDB-style files is described here.)

Timeline for d7bq5a2: