![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
![]() | Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) ![]() both first two domains are of same beta/beta/alpha fold |
![]() | Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins) |
![]() | Protein Glutathione reductase [55426] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [55428] (4 PDB entries) |
![]() | Domain d1geua3: 1geu A:336-450 [40174] Other proteins in same PDB: d1geua1, d1geua2, d1geub1, d1geub2 complexed with fad, nad |
PDB Entry: 1geu (more details), 2.2 Å
SCOPe Domain Sequences for d1geua3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1geua3 d.87.1.1 (A:336-450) Glutathione reductase {Escherichia coli [TaxId: 562]} ysniptvvfshppigtvgltepqareqygddqvkvykssftamytavtthrqpcrmklvc vgseekivgihgigfgmdemlqgfavalkmgatkkdfdntvaihptaaeefvtmr
Timeline for d1geua3: