Lineage for d1geua3 (1geu A:336-450)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135463Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 135464Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
  5. 135465Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (8 proteins)
  6. 135493Protein Glutathione reductase [55426] (2 species)
  7. 135494Species Escherichia coli [TaxId:562] [55428] (4 PDB entries)
  8. 135501Domain d1geua3: 1geu A:336-450 [40174]
    Other proteins in same PDB: d1geua1, d1geua2, d1geub1, d1geub2

Details for d1geua3

PDB Entry: 1geu (more details), 2.2 Å

PDB Description: anatomy of an engineered nad-binding site

SCOP Domain Sequences for d1geua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1geua3 d.87.1.1 (A:336-450) Glutathione reductase {Escherichia coli}
ysniptvvfshppigtvgltepqareqygddqvkvykssftamytavtthrqpcrmklvc
vgseekivgihgigfgmdemlqgfavalkmgatkkdfdntvaihptaaeefvtmr

SCOP Domain Coordinates for d1geua3:

Click to download the PDB-style file with coordinates for d1geua3.
(The format of our PDB-style files is described here.)

Timeline for d1geua3: