SCOPe 2.08: Domain d7brfa2: 7brf A:182-468

Lineage for d7brfa2 (7brf A:182-468)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.2: AglA-like glucosidase [90050] (5 proteins)
   family 4 glycosyl hydrolase
   automatically mapped to Pfam PF11975

6. Protein automated matches [227094] (4 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [384650] (3 PDB entries)

8. Domain d7brfa2: 7brf A:182-468 [401734]
   Other proteins in same PDB: d7brfa1, d7brfa3
   automated match to d1vjta2
   complexed with nai

Details for d7brfa2

PDB Entry: 7brf, 2.15 Å

PDB Description: structure of nadh complex of thermotoga maritima alpha-glucuronidase at 2.15 angstrom resolution

PDB Compounds: (A:) Alpha-glucosidase, putative

SCOPe Domain Sequences for d7brfa2:

Sequence; same for both SEQRES and ATOM records:

>d7brfa2 d.162.1.2 (A:182-468) automated matches {Thermotoga maritima [TaxId: 243274]}
hgvagvyevfekldldpeevdwqvagvnhgiwlnrfryrgedayplldewiekklpewep
knpwdtqmspaamdmykfygmlpigdtvrngswkyhynletkkkwfgkfggidneverpk
fheqlrrarerliklaeevqqnpgmklteehpeifpkgklsgeqhipfinaiannkrvrl
flnvenqgtlkdfpddvvmelpvwvdccgihrekvepdlthrikifylwprilrmewnle
ayisrdrkvleeilirdprtksyeqivqvldeifnlpfneelrryyk

Timeline for d7brfa2:

• d7brfa2 first appeared in SCOPe 2.07