SCOP 1.57: Domain d1getb3: 1get B:336-450

Lineage for d1getb3 (1get B:336-450)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (8 proteins)

6. Protein Glutathione reductase [55426] (2 species)

7. Species Escherichia coli [TaxId:562] [55428] (4 PDB entries)

8. Domain d1getb3: 1get B:336-450 [40173]
   Other proteins in same PDB: d1geta1, d1geta2, d1getb1, d1getb2

Details for d1getb3

PDB Entry: 1get, 2 Å

PDB Description: anatomy of an engineered nad-binding site

SCOP Domain Sequences for d1getb3:

Sequence; same for both SEQRES and ATOM records:

>d1getb3 d.87.1.1 (B:336-450) Glutathione reductase {Escherichia coli}
ysniptvvfshppigtvgltepqareqygddqvkvykssftamytavtthrqpcrmklvc
vgseekivgihgigfgmdemlqgfavalkmgatkkdfdntvaihptaaeefvtmr

Timeline for d1getb3:

• d1getb3 first appeared (with stable ids) in SCOP 1.55
  
• d1getb3 appears in SCOP 1.59
  
• d1getb3 appears in the current release, SCOPe 2.08