Lineage for d1getb3 (1get B:336-450)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34139Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 34140Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
  5. 34141Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (7 proteins)
  6. 34166Protein Glutathione reductase [55426] (2 species)
  7. 34167Species Escherichia coli [TaxId:562] [55428] (4 PDB entries)
  8. 34173Domain d1getb3: 1get B:336-450 [40173]
    Other proteins in same PDB: d1geta1, d1geta2, d1getb1, d1getb2

Details for d1getb3

PDB Entry: 1get (more details), 2 Å

PDB Description: anatomy of an engineered nad-binding site

SCOP Domain Sequences for d1getb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1getb3 d.87.1.1 (B:336-450) Glutathione reductase {Escherichia coli}
ysniptvvfshppigtvgltepqareqygddqvkvykssftamytavtthrqpcrmklvc
vgseekivgihgigfgmdemlqgfavalkmgatkkdfdntvaihptaaeefvtmr

SCOP Domain Coordinates for d1getb3:

Click to download the PDB-style file with coordinates for d1getb3.
(The format of our PDB-style files is described here.)

Timeline for d1getb3: