| Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
| Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) |
Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) ![]() |
| Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (7 proteins) |
| Protein Glutathione reductase [55426] (2 species) |
| Species Escherichia coli [TaxId:562] [55428] (4 PDB entries) |
| Domain d1geta3: 1get A:336-450 [40172] Other proteins in same PDB: d1geta1, d1geta2, d1getb1, d1getb2 |
PDB Entry: 1get (more details), 2 Å
SCOP Domain Sequences for d1geta3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1geta3 d.87.1.1 (A:336-450) Glutathione reductase {Escherichia coli}
ysniptvvfshppigtvgltepqareqygddqvkvykssftamytavtthrqpcrmklvc
vgseekivgihgigfgmdemlqgfavalkmgatkkdfdntvaihptaaeefvtmr
Timeline for d1geta3: