SCOPe 2.08: Domain d1geta3: 1get A:336-450

Lineage for d1geta3 (1get A:336-450)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)
   both first two domains are of same beta/beta/alpha fold

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)

6. Protein Glutathione reductase [55426] (3 species)

7. Species Escherichia coli [TaxId:562] [55428] (4 PDB entries)

8. Domain d1geta3: 1get A:336-450 [40172]
   Other proteins in same PDB: d1geta1, d1geta2, d1getb1, d1getb2
   complexed with fad, nap

Details for d1geta3

PDB Entry: 1get, 2 Å

PDB Description: anatomy of an engineered nad-binding site

PDB Compounds: (A:) glutathione reductase

SCOPe Domain Sequences for d1geta3:

Sequence; same for both SEQRES and ATOM records:

>d1geta3 d.87.1.1 (A:336-450) Glutathione reductase {Escherichia coli [TaxId: 562]}
ysniptvvfshppigtvgltepqareqygddqvkvykssftamytavtthrqpcrmklvc
vgseekivgihgigfgmdemlqgfavalkmgatkkdfdntvaihptaaeefvtmr

Timeline for d1geta3:

• d1geta3 first appeared (with stable ids) in SCOP 1.55
  
• d1geta3 appears in SCOPe 2.07