| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) ![]() both first two domains are of same beta/beta/alpha fold |
| Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins) |
| Protein Glutathione reductase [55426] (3 species) |
| Species Escherichia coli [TaxId:562] [55428] (4 PDB entries) |
| Domain d1gerb3: 1ger B:336-450 [40171] Other proteins in same PDB: d1gera1, d1gera2, d1gerb1, d1gerb2 complexed with fad |
PDB Entry: 1ger (more details), 1.86 Å
SCOPe Domain Sequences for d1gerb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gerb3 d.87.1.1 (B:336-450) Glutathione reductase {Escherichia coli [TaxId: 562]}
ysniptvvfshppigtvgltepqareqygddqvkvykssftamytavtthrqpcrmklvc
vgseekivgihgigfgmdemlqgfavalkmgatkkdfdntvaihptaaeefvtmr
Timeline for d1gerb3: