Lineage for d1gerb3 (1ger B:336-450)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81993Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 81994Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
  5. 81995Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (8 proteins)
  6. 82023Protein Glutathione reductase [55426] (2 species)
  7. 82024Species Escherichia coli [TaxId:562] [55428] (4 PDB entries)
  8. 82028Domain d1gerb3: 1ger B:336-450 [40171]
    Other proteins in same PDB: d1gera1, d1gera2, d1gerb1, d1gerb2

Details for d1gerb3

PDB Entry: 1ger (more details), 1.86 Å

PDB Description: the structure of glutathione reductase from escherichia coli at 1.86 angstroms resolution: comparison with the enzyme from human erythrocytes

SCOP Domain Sequences for d1gerb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gerb3 d.87.1.1 (B:336-450) Glutathione reductase {Escherichia coli}
ysniptvvfshppigtvgltepqareqygddqvkvykssftamytavtthrqpcrmklvc
vgseekivgihgigfgmdemlqgfavalkmgatkkdfdntvaihptaaeefvtmr

SCOP Domain Coordinates for d1gerb3:

Click to download the PDB-style file with coordinates for d1gerb3.
(The format of our PDB-style files is described here.)

Timeline for d1gerb3: