Lineage for d7avrg1 (7avr G:3-300)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2510124Species Paraglaciecola agarilytica [TaxId:1125747] [401628] (1 PDB entry)
  8. 2510131Domain d7avrg1: 7avr G:3-300 [401705]
    Other proteins in same PDB: d7avrc2, d7avrf2, d7avrg2
    automated match to d1hdea_
    complexed with cl

Details for d7avrg1

PDB Entry: 7avr (more details), 2 Å

PDB Description: the tetrameric structure of haloalkane dehalogenase dpaa from paraglaciecola agarilytica no2
PDB Compounds: (G:) Haloalkane dehalogenase 1

SCOPe Domain Sequences for d7avrg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7avrg1 c.69.1.0 (G:3-300) automated matches {Paraglaciecola agarilytica [TaxId: 1125747]}
ikalrtpeerfsvlpafpyqpnyvddlggyeslrmayidegdkdseytflclhgeptwsy
lyrkmipvftdaghrvvapdlfgfgrsdkpiedsvynfefhrnsliqliehldlknivlv
cqdwggglgltipmdmqdrfkklivmnttisngeplaeaavqwmafnetiselpvaglva
cdagaavnvmdalaydapfpnknykvgvkrfpqmiptnadddavkyglraiefwsnewsg
esfmaigmkdavlgeaammqlktvikgcpepmkieeaghfvqeygvevaeqalasftm

SCOPe Domain Coordinates for d7avrg1:

Click to download the PDB-style file with coordinates for d7avrg1.
(The format of our PDB-style files is described here.)

Timeline for d7avrg1: