Lineage for d7bbra_ (7bbr A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915176Species Advenella mimigardefordensis [TaxId:1247726] [401671] (5 PDB entries)
  8. 2915177Domain d7bbra_: 7bbr A: [401680]
    automated match to d4mx6a_
    complexed with kdg

Details for d7bbra_

PDB Entry: 7bbr (more details), 1.3 Å

PDB Description: crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t
PDB Compounds: (A:) Putative TRAP transporter solute receptor DctP

SCOPe Domain Sequences for d7bbra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bbra_ c.94.1.0 (A:) automated matches {Advenella mimigardefordensis [TaxId: 1247726]}
kdikpriirfgygladdsptgkasahfaevvsklsdgkmkvktfgngalgpdeqlinsli
sgsgeitfvstapiaslipefgvfdlpflfdnekvadtvldgpegkklldklpakgligl
nywengfrnitnsrheisklddiggiklrvmqnqvalsvfkglganaipmpftelftale
tktvdgqenplstiqtskfyevqpyltlsnhvytpfvflaskkwfdqlsqdekdvitqaa
adsqafqrkasrqgnedalkylkehnvkvaefsteerekirekvapiveslkakigketv
egvldaakka

SCOPe Domain Coordinates for d7bbra_:

Click to download the PDB-style file with coordinates for d7bbra_.
(The format of our PDB-style files is described here.)

Timeline for d7bbra_: