SCOPe 2.07: Domain d7bcob_: 7bco B:

Lineage for d7bcob_ (7bco B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Advenella mimigardefordensis [TaxId:1247726] [401671] (5 PDB entries)

8. Domain d7bcob_: 7bco B: [401674]
   automated match to d4mx6a_
   complexed with tf8

Details for d7bcob_

PDB Entry: 7bco, 2 Å

PDB Description: crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate

PDB Compounds: (B:) Putative TRAP transporter solute receptor DctP

SCOPe Domain Sequences for d7bcob_:

Sequence; same for both SEQRES and ATOM records:

>d7bcob_ c.94.1.0 (B:) automated matches {Advenella mimigardefordensis [TaxId: 1247726]}
dikpriirfgygladdsptgkasahfaevvsklsdgkmkvktfgngalgpdeqlinslis
gsgeitfvstapiaslipefgvfdlpflfdnekvadtvldgpegkklldklpakgligln
ywengfrnitnsrheisklddiggiklrvmqnqvalsvfkglganaipmpftelftalet
ktvdgqenplstiqtskfyevqpyltlsnhvytpfvflaskkwfdqlsqdekdvitqaaa
dsqafqrkasrqgnedalkylkehnvkvaefsteerekirekvapiveslkakigketve
gvldaakkas

Timeline for d7bcob_:

• d7bcob_ is new in SCOPe 2.07-stable
  
• d7bcob_ appears in the current release, SCOPe 2.08