Lineage for d5grt_3 (5grt 364-478)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 415132Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 415133Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 415134Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (10 proteins)
  6. 415168Protein Glutathione reductase [55426] (3 species)
  7. 415178Species Human (Homo sapiens) [TaxId:9606] [55427] (17 PDB entries)
  8. 415193Domain d5grt_3: 5grt 364-478 [40164]
    Other proteins in same PDB: d5grt_1, d5grt_2
    complexed with fad, ts4; mutant

Details for d5grt_3

PDB Entry: 5grt (more details), 2.4 Å

PDB Description: human glutathione reductase a34e, r37w mutant, glutathionylspermidine complex

SCOP Domain Sequences for d5grt_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5grt_3 d.87.1.1 (364-478) Glutathione reductase {Human (Homo sapiens)}
ynniptvvfshppigtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvc
ankeekvvgihmqglgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr

SCOP Domain Coordinates for d5grt_3:

Click to download the PDB-style file with coordinates for d5grt_3.
(The format of our PDB-style files is described here.)

Timeline for d5grt_3: