SCOPe 2.08: Domain d6zyqa_: 6zyq A:

Lineage for d6zyqa_ (6zyq A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (31 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [189718] (103 PDB entries)

8. Domain d6zyqa_: 6zyq A: [401620]
   automated match to d4eyba_
   complexed with qst, so4, zn

Details for d6zyqa_

PDB Entry: 6zyq, 1.7 Å

PDB Description: structure of ndm-1 with 2-mercaptomethyl-thiazolidine d-syn-1b

PDB Compounds: (A:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d6zyqa_:

Sequence; same for both SEQRES and ATOM records:

>d6zyqa_ d.157.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
irptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvd
tawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlap
qegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggcli
kdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

Timeline for d6zyqa_:

• d6zyqa_ first appeared in SCOPe 2.07