Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) both first two domains are of same beta/beta/alpha fold |
Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins) |
Protein Glutathione reductase [55426] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [55427] (17 PDB entries) |
Domain d4gr1a3: 4gr1 A:364-478 [40162] Other proteins in same PDB: d4gr1a1, d4gr1a2 complexed with fad, po4, rgs |
PDB Entry: 4gr1 (more details), 2.4 Å
SCOP Domain Sequences for d4gr1a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gr1a3 d.87.1.1 (A:364-478) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} ynniptvvfshppigtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvc ankeekvvgihmqglgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr
Timeline for d4gr1a3: