Lineage for d1grfa3 (1grf A:364-478)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528291Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2528292Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2528293Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2528333Protein Glutathione reductase [55426] (3 species)
  7. 2528343Species Human (Homo sapiens) [TaxId:9606] [55427] (23 PDB entries)
  8. 2528358Domain d1grfa3: 1grf A:364-478 [40160]
    Other proteins in same PDB: d1grfa1, d1grfa2
    complexed with acm, fad, po4

Details for d1grfa3

PDB Entry: 1grf (more details), 2 Å

PDB Description: substrate binding and catalysis by glutathione reductase as derived from refined enzyme: substrate crystal structures at 2 angstroms resolution
PDB Compounds: (A:) glutathione reductase

SCOPe Domain Sequences for d1grfa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1grfa3 d.87.1.1 (A:364-478) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}
ynniptvvfshppigtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvc
ankeekvvgihmqglgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr

SCOPe Domain Coordinates for d1grfa3:

Click to download the PDB-style file with coordinates for d1grfa3.
(The format of our PDB-style files is described here.)

Timeline for d1grfa3: