| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) ![]() both first two domains are of same beta/beta/alpha fold |
| Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins) |
| Protein Glutathione reductase [55426] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55427] (23 PDB entries) |
| Domain d1graa3: 1gra A:364-478 [40157] Other proteins in same PDB: d1graa1, d1graa2 complexed with fad, gsh, ndp |
PDB Entry: 1gra (more details), 2 Å
SCOPe Domain Sequences for d1graa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1graa3 d.87.1.1 (A:364-478) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}
ynniptvvfshppigtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvc
ankeekvvgihmqglgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr
Timeline for d1graa3: