Lineage for d6zt5c2 (6zt5 C:244-426)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930912Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2930913Protein automated matches [190826] (23 species)
    not a true protein
  7. 2931126Species Mycolicibacterium smegmatis [TaxId:246196] [401564] (2 PDB entries)
  8. 2931128Domain d6zt5c2: 6zt5 C:244-426 [401565]
    Other proteins in same PDB: d6zt5c1
    automated match to d1s16a1
    protein/DNA complex; complexed with so4

Details for d6zt5c2

PDB Entry: 6zt5 (more details), 2.2 Å

PDB Description: complex between a homodimer of mycobacterium smegmatis mfpa and a single copy of the n-terminal 47 kda fragment of the mycobacterium smegmatis dna gyrase b subunit
PDB Compounds: (C:) DNA gyrase subunit b

SCOPe Domain Sequences for d6zt5c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zt5c2 d.14.1.0 (C:244-426) automated matches {Mycolicibacterium smegmatis [TaxId: 246196]}
skvkhrvfhypgglvdyvkhinrtktpiqqsiidfdgkgpgheveiamqwnagysesvht
fantintheggtheegfraaltsvvnryakdkkllkdkdpnltgddireglaavisvkva
epqfegqtktklgntevksfvqkicneqlqhwfeanpaeaktvvnkavssaqariaarka
rel

SCOPe Domain Coordinates for d6zt5c2:

Click to download the PDB-style file with coordinates for d6zt5c2.
(The format of our PDB-style files is described here.)

Timeline for d6zt5c2: