Lineage for d1xana3 (1xan A:364-478)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. Protein Glutathione reductase [55426] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [55427] (23 PDB entries)
  8. Domain d1xana3: 1xan A:364-478 [40156]
    Other proteins in same PDB: d1xana1, d1xana2
    complexed with fad, hxp

Details for d1xana3

PDB Entry: 1xan (more details), 2 Å

PDB Description: human glutathione reductase in complex with a xanthene inhibitor
PDB Compounds: (A:) glutathione reductase

SCOPe Domain Sequences for d1xana3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xana3 d.87.1.1 (A:364-478) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}
ynniptvvfshppigtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvc
ankeekvvgihmqglgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr

SCOPe Domain Coordinates for d1xana3 are not available.

Timeline for d1xana3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xana1, d1xana2